PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG019070t1
Common NameTCM_019070
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 182aa    MW: 21118.3 Da    PI: 6.0246
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG019070t1genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_151.22.7e-1682140563
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                       +++rr+++NRe+ArrsR RK+  ++eL   v  L +eN++L+++l++ ++  +k+ +e+
  Thecc1EG019070t1  82 RKQRRMISNRESARRSRMRKQRHLDELWSQVVWLRNENHQLIDKLNHVSESHDKVLQEN 140
                       689************************************************99999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.3E-1578142IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.64580143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1703.5E-1382155No hitNo description
SuperFamilySSF579591.45E-1382132No hitNo description
PfamPF001706.5E-1482140IPR004827Basic-leucine zipper domain
CDDcd147022.19E-1883134No hitNo description
PROSITE patternPS00036085100IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 182 aa     Download sequence    Send to blast
MQPSEVSGLH YLVPSNPSPY SAHFGMNHSN TPTFELNRFS NPLYNFYIPP QFQEINPHSS  60
CLSSNSTSDE ADEQQLSLIN ERKQRRMISN RESARRSRMR KQRHLDELWS QVVWLRNENH  120
QLIDKLNHVS ESHDKVLQEN AQLKEEASEL RQMLSDMQLS SPYSTLRDLE DIALEHGLSE  180
N*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
194101RRSRMRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00389DAPTransfer from AT3G30530Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007032940.11e-131Basic leucine-zipper 42
SwissprotQ9FMC25e-49BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A061EG401e-131A0A061EG40_THECC; Basic leucine-zipper 42
STRINGPOPTR_0004s10990.17e-94(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM31122667
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.17e-60basic leucine-zipper 42
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]